DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and T16G1.4

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506236.2 Gene:T16G1.4 / 179776 WormBaseID:WBGene00011798 Length:424 Species:Caenorhabditis elegans


Alignment Length:332 Identity:61/332 - (18%)
Similarity:123/332 - (37%) Gaps:84/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GDHYASVMFRAVSHYSTAKGNFSKALIVK------------TMPEQE------GHKKDMLSNSPI 99
            |:.:.|.:......::....|..|..|:|            .:.|.|      .::.|:::   :
 Worm    50 GNGFMSRVILVEPEWTITDENLPKKFILKITSCLHVVGLLEKLKESEQNVINDANEADLMA---L 111

  Fly   100 FKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFEDLVPQGYT----------- 153
            |:.|..::......|.:|.::.....:|.:|.||         .::....:..|           
 Worm   112 FENESRLFHNREVNLYKITKKWNKNDELLSPKIY---------FYKKFDSENQTKGILGMEAVDD 167

  Fly   154 -VIRDRYPNKE--ELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLNDSIVTTGVPC 215
             .:|..|.|.:  ||......:|:..|.|:.:.::....:..|  .|..|.|.:           
 Worm   168 VTVRHLYYNVKPFELHSVLKSIARLQAESLHLTDQEKQSIAGF--DLKKMSNTI----------- 219

  Fly   216 FLE--MLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTN-------PKPNRYY-----VLCHG 266
            |.|  |.:...:..:..|  |::|::..:     :|.|.|.       ...|.|.     ||.||
 Worm   220 FSEEGMQNNFKQTREINP--ERLKESVDK-----VEIYGTELVDLDKAINLNSYIGIERDVLVHG 277

  Fly   267 DFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDR---WD-LGKEYINY 327
            |....|:::..|:  |.|....::|:|:.::...:.||:..:...:...||   |: |.:::..|
 Worm   278 DLWSANILWEENE--GKFLVSKVIDYQLIHMGNPAEDLVRLLLCTLSGADRQAHWERLLEQFYEY 340

  Fly   328 YFSVLAD 334
            :...|.|
 Worm   341 FLEALQD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 61/332 (18%)
T16G1.4NP_506236.2 DUF1679 7..419 CDD:369592 61/332 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.