DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and T16G1.5

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans


Alignment Length:450 Identity:80/450 - (17%)
Similarity:163/450 - (36%) Gaps:90/450 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EGALRAYEKDPELHV-------TDLKISPATL-----QGDHYASVMFRAVSHYSTAKGNFSKALI 79
            :|....:.|..::.:       ||.|:...|.     .|:.:.|.:....:.::....|..:.:|
 Worm    13 DGLFETHVKLEDIQILIKEQMNTDSKLGEKTKLTVVGDGNGFMSRVVLVEADWTIPNENLPEKII 77

  Fly    80 VKTMPEQEGHK--KDMLSNSP-------------IFKTEILMYSKALPELERILREAGDTTKLYA 129
            :|.......|.  ..|...:|             :|:.|..........|.||..:......|.:
 Worm    78 LKLTSCINVHHLVSQMKEKNPDAFTEQQEAELWAMFEREAQNVHNREVNLYRITEKWNKNDALLS 142

  Fly   130 PCIYHSLE-----PHQVMIFEDLVPQGYTVIRDRYPNKE--ELQKAFFKLAKWHAASMKVLNERP 187
            |.||...:     ..|.::..:.|..  .|:|..|.|.:  ||......||...|.|:.:..:..
 Worm   143 PKIYFYKKFDCENKTQGVLGMEYVDD--AVVRHLYCNAKPHELHPILQSLATLQAGSLHLTEDEI 205

  Fly   188 DFLKEFKYGLWGMPNFLNDSIVTTGVPCFLEMLDKV-PE-LTKYKPYFEKIKDNYIQ-QMSAVME 249
            :.:..:.:     .:.:...:...|:........:: || |||.....|.:..:.:. ::|..:.
 Worm   206 NSISGYDF-----KSMVGRMMSEEGMKQMYTRARQINPERLTKPTDAVEALGMDIVNFEISCHVN 265

  Fly   250 EYRTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDT 314
            :|....|    .||.|||....|::::.|  .|:.....::|:|:.::...:.||:......:..
 Worm   266 KYAGIQK----NVLVHGDLWAANILWKEN--DGNCVASKVIDYQLIHMGNPAEDLVRVFLSTLSG 324

  Fly   315 EDR---WD-LGKEYINYYFSVL--------ADTLK---KIGFKGEMPTQTGVWEHIHGHKDYEFF 364
            .||   |: |.:::..|:...|        .|.||   ::.|.|.                 ..|
 Worm   325 ADRQAHWEKLLEQFYEYFLEALEGNEAPYTLDQLKESYRLYFVGG-----------------GLF 372

  Fly   365 MMTSFLPLVAAMNTKTF--KSMDSFFDPQTKQKSFFLDE------YITDVKMLLRKFEEL 416
            :|..|.|:..|..:.:.  ::::.:.:..|::....:::      |..||...|...|:|
 Worm   373 VMPLFGPVAQAKLSYSTDNENVEEYREVLTEKAERLMEDLKRWHLYSKDVTKDLETAEKL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 60/328 (18%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:369592 75/436 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.