DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13658 and F59B1.8

DIOPT Version :9

Sequence 1:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:356 Identity:71/356 - (19%)
Similarity:130/356 - (36%) Gaps:104/356 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QGDHYASVMFRAVSHYSTAKGNFSKALIVKTM---------------------PEQEGHKKDMLS 95
            :|:.::|.:.....|::....:..|.||:|.:                     ||:|.|......
 Worm    50 EGNGFSSCVILITCHWTIPSSHLPKKLILKIVSFVHVQGLLNKSNEEGNSVMSPEEEAHVHAHFE 114

  Fly    96 NS--PIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFEDLVP-QGY----- 152
            .|  .....|: .:.:|...||.:|          .|.::.|.:      ||:..| :|:     
 Worm   115 KSCQKGHNLEV-EFCEAFGHLEGLL----------LPKVFFSQK------FEEDNPNKGFVGMEF 162

  Fly   153 ---TVIRDRYPN--KEELQKAFFKLAKWHAASMKVLNERP-DFLKEFKYGLWGMPNFLNDSIVTT 211
               :|:|..|.|  .:|||.....||:..|.|:...:.|. |..:.|:..|              
 Worm   163 VEGSVVRHCYENVTVDELQPILKALARLQALSLSTESCRNLDNGEAFEESL-------------- 213

  Fly   212 GVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKP----------NRYY----- 261
                 ::||.:    ...|..|::.: |..|::|..:|....|.|.          |:..     
 Worm   214 -----MDMLSE----DGLKGIFDQSR-NIDQKLSEKVERIEQNHKEILNLETVLNLNKVVGIDQK 268

  Fly   262 VLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYIN 326
            |:||||....|::  :.:..|.|....::|:|.|::...:.||:..:...:...||....:..:.
 Worm   269 VICHGDLWAANIL--WTQTDGGFIADKVLDYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILE 331

  Fly   327 YYFSVLAD---------TLK--KIGFKGEMP 346
            .:::...|         ||:  |..||...|
 Worm   332 QFYTYFTDEIGSNNAPYTLEQLKTSFKLYFP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 68/349 (19%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 71/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.