DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and pkdc

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:233 Identity:50/233 - (21%)
Similarity:74/233 - (31%) Gaps:66/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ERMAIIFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRY 189
            |...|:.|||.|.|:.:  |...:|:......|..:|.|||.          .|:....|.    
Zfish   106 EEQLIVLEDLDVAGFPV--RKTYVNDAEIKACLSWIANFHAL----------FLDVTPEGL---- 154

  Fly   190 TNAYSGYFVGGLLAAARWMSKVPTLAHY-----------GEKLFALAPHYMDIGRECFAPTPGQV 243
                             |  .:.|..|.           .:||.|.|.....|...|      :.
Zfish   155 -----------------W--PIGTYWHLETRPEELEAMSDQKLKAAAGEIDSILNNC------RF 194

  Fly   244 NVLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLF 308
            ..:.|||....|..|..|     .:.|..:||||...|....|:.:...:.:.|.....:..||.
Zfish   195 KTIVHGDAKLANFCFSKD-----GLQVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLL 254

  Fly   309 QFYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFA 346
            .:|.....::|||         .:...:||.|.:..||
Zfish   255 DYYFSELRKSLEK---------KVDFAELEKEWRNMFA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 45/209 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 43/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.