DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG10550

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:432 Identity:119/432 - (27%)
Similarity:191/432 - (44%) Gaps:52/432 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIVK 69
            |:|:..||.:..:....::....|..:.| .|..|||||..::.|..|:..|.:..:...:.|:|
  Fly    20 PKWINEEYFQPIIEKDVENFDKIINLVPI-AATAPGENYTSIMIRVIVDILLKDGSEQRVSYILK 83

  Fly    70 TEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDR--ERMAIIFE 132
            |.::.|. ..:::....::.:|..:|:..:|:..:|..|.|....:.|..::||.  |.:.::||
  Fly    84 TMLEADS-GADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFE 147

  Fly   133 DLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYSGYF 197
            |||...:...||::..:..|...:|||||:.|||:.|..|........|:...:|..:.      
  Fly   148 DLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSR------ 206

  Fly   198 VGGLLAAARWMSKVPTLAHYGEKLFALAPHYMDIGR------------ECF--APTPGQV----- 243
                       ....:|....|:.|..|....|:..            |.|  |....||     
  Fly   207 -----------DLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDEDEF 260

  Fly   244 NVLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLF 308
            |||.|||.|:||:||.|..| |.....:|:|.|...||||..||.:|..||....::..:.:...
  Fly   261 NVLNHGDCWSNNIMFNYKDN-GEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFI 324

  Fly   309 QFYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQ-DPTDACFNALM- 371
            |.||:...|.|:.||| ...||:|....:.:.:..|:   ..:....||::. .|||...|..| 
  Fly   325 QIYHQRLAECLKLLNY-SKPIPTLRDLHIMMLKYGFW---GPLTAMGVMVATLMPTDKDANMKMI 385

  Fly   372 ---NDDERGIRFKNRLYNNPTVQQNLHSLVPFFDRKGLLEVN 410
               ..:...||:  |.:.||...:.:..|:||||.||||:.|
  Fly   386 LAQGPEADAIRY--RTFINPYYAKAMKVLLPFFDNKGLLKSN 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 84/305 (28%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 84/305 (28%)
APH 108..338 CDD:279908 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.