DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG13659

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:412 Identity:113/412 - (27%)
Similarity:191/412 - (46%) Gaps:18/412 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIVK 69
            ||||..:::...||.:.||..|.:..|...||...|::|..::.|||||:|..| ....::||:|
  Fly    14 PEWLNVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRARVEYTAQN-GNFTKSLIIK 77

  Fly    70 TEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVD-RERMAIIFED 133
            |.|.::.:.:::.....::..|:.:|.:|||:...:|....|..:::...||.. :....:||:|
  Fly    78 TMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWERILRRANDPAKLYVECIYHSLQPHQILIFDD 142

  Fly   134 LSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYSGYFV 198
            |..:||.:. |.|.|..|.......||||.||.:......|...|:.:..|.........|....
  Fly   143 LVEMGYAVV-RDRFLTREEISSAYSKLAKIHAISMKFIHEQPEYLKEFKNGLCEMPGLIDSSIIS 206

  Fly   199 GGLLAAARWMSKVPTLAHYGEKLFALAPHYMDIGRECFA-----PTPGQVNVLAHGDVWTNNVMF 258
            ||:......:.::|.|:.|......::.|:.|..||...     |.|| .|||.|.|..:.|:||
  Fly   207 GGMDPFMEMLGRIPELSKYQPHFKKISLHFKDRLRETMQEYRNNPQPG-YNVLCHADFHSRNMMF 270

  Fly   259 KYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTETLEKLN 323
            |.:..||...|.:|:|:|........:||.:.....:....||::.:.|..:|..|..|||:|:.
  Fly   271 KNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGPAQRREELDILLNYYLSILLETLKKIG 335

  Fly   324 YRQNQIPSLHQFKLEVEQKRF--FALHSTVVVQPVMISQDPTDACFNALMNDDERGIRFKNRLYN 386
            | |..:|:...|..|:::.|:  |.|.||.:  ||.|...........:|:::|.    :.:||.
  Fly   336 Y-QGSMPTEQGFWAEMKRHRYYEFLLLSTFL--PVSIGLRTHKLDIGDMMHNEET----RKKLYQ 393

  Fly   387 NPTVQQNLHSLVPFFDRKGLLE 408
            .....:...|::..|.:.|..:
  Fly   394 LEDFMEETKSILDRFQKSGYFD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 81/290 (28%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 81/290 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.