DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG13658

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:360 Identity:111/360 - (30%)
Similarity:171/360 - (47%) Gaps:22/360 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIV 68
            ||.||..|.||.|||.:.||..|.:|.|:|:||...|::|..|:.||...::.: |....:.|||
  Fly    17 APAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTA-KGNFSKALIV 80

  Fly    69 KTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRE-RMAIIFE 132
            ||..:.:...:::::...|:..|:.:|.:.||:...:|.|.|||.:::...||...| ...:|||
  Fly    81 KTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIFE 145

  Fly   133 DLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAAT-AVLNERQSGCLESYDRGFFNRYTNAYSGY 196
            ||...||.:. |.|..|:|.......||||:|||: .|||||.. .|:.:..|.:..........
  Fly   146 DLVPQGYTVI-RDRYPNKEELQKAFFKLAKWHAASMKVLNERPD-FLKEFKYGLWGMPNFLNDSI 208

  Fly   197 FVGGLLAAARWMSKVPTLAHYGEKLFALAPHY---MDIGRECFA--PTPGQVNVLAHGDVWTNNV 256
            ...|:......:.|||.|..|......:..:|   |....|.:.  |.|.:..||.|||....|:
  Fly   209 VTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPNRYYVLCHGDFHGRNM 273

  Fly   257 MFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTETLEK 321
            ||:|:..||...||:|:|||.|......|||.:.....:....|.|.......:|..:..:||:|
  Fly   274 MFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYINYYFSVLADTLKK 338

  Fly   322 LNYRQNQIPS-------LHQFKLEVEQKRFFALHS 349
            :.:: .::|:       :|..|    ...||.:.|
  Fly   339 IGFK-GEMPTQTGVWEHIHGHK----DYEFFMMTS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 87/291 (30%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 87/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.