DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG14314

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:371 Identity:94/371 - (25%)
Similarity:157/371 - (42%) Gaps:54/371 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GENYGGVLTRARVEFTLSNKEKNV---QNLIVKTEIDDDELTQELMAPYDIYNREMTIYQEVLPK 101
            |:||...|.|.:    |:.|.:::   ||:|.|. :.:..:.:|......::..|:..|..::| 
  Fly    56 GDNYTAALYRIK----LTGKRRSLKWEQNVICKV-MPESVVAREAYKSDKLFRNEVQFYNTIMP- 114

  Fly   102 CRELLN-EIGDTERIFP--TAI---YVDRERMAIIFEDLSVVGYVMADRVRRLNEEHTHLILRKL 160
              |||. :...|.:..|  .||   |..|..: :|.|||...|:.|:||.:.|:.|.|..:|.::
  Fly   115 --ELLKFQASKTNQDTPVFNAIPKCYSARHDL-LIMEDLRERGFQMSDRHKGLSLEETQSVLLQV 176

  Fly   161 AKFHAATAVLNERQ----SGCLESYDRGFF-NRYTNAYSGYFVGGLLAAARWMSKV-PTLAHYGE 219
            |:.|..:......:    |........|.| ...|:.|..|:......|.:.:|:| |..:.|..
  Fly   177 AQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVL 241

  Fly   220 KLFALAPHYMDIGREC-FAPTPGQVNVLAHGDVWTNNVMFKYDP-NTGRPVDVLLIDFQYSFWGS 282
            .:...|......||.. .|.|...::.:.|||.|.||.::.||| :..|.::|.|:|||...:.|
  Fly   242 AMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSS 306

  Fly   283 PCIDLHHLFNTSLKEPLRRDQQNGLFQFY-HKIF-------------TETLEKLNYRQNQIPSLH 333
            ..:|:.:|......:.:|..|...|.:.| .::|             .:||:||.         .
  Fly   307 IALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQ---------D 362

  Fly   334 QFKLEVEQKRFFALHSTVVVQPVMI--SQDPTDACFNALMNDDERG 377
            .|..|::....|||...:.:.|:..  |:|..|.   .|...||.|
  Fly   363 LFAEELKTYGRFALGLALDILPISTCSSEDAPDM---YLDRSDELG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 81/314 (26%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 77/298 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.