DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG6830

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:425 Identity:118/425 - (27%)
Similarity:202/425 - (47%) Gaps:33/425 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIVK 69
            |:||.....|..|.... |:...|...::.||:.|||||..::.|..::..|::|...:.:.::|
  Fly    47 PKWLNQTQFEELLAADV-DQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMK 110

  Fly    70 TEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRER-----MAI 129
            ...|..:: :::|:..:.:..|...|.|:|||..||....|...:..|.|..:|..:     ..:
  Fly   111 VPHDTPQM-EQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTV 174

  Fly   130 IFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYS 194
            :..||...|:...:|:..||.|.|...|.:||:||||.|.:.:......:.:..|.......|..
  Fly   175 LMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMGNNKEAII 239

  Fly   195 GYFVGGLLAAARW-----MSKVPTLAHYGEK----LFALAPHYMDIGRECFAPTPGQVNVLAHGD 250
            . |:.|:||:.|.     :.|......|.||    |..|...:|.:|    ...|.:.|.|.|||
  Fly   240 A-FMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLG----IVDPNEFNALNHGD 299

  Fly   251 VWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIF 315
            .|.||::||.: ::|...|::.:|||...:|||.:||.:...:|    ::.|.:...|.|:.:.:
  Fly   300 CWMNNLLFKMN-SSGDLEDMVFVDFQNPKYGSPAMDLLYFIISS----VQIDYKLSHFDFFIRHY 359

  Fly   316 TETLEK----LNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPT-DACFNALMNDDE 375
            .|.|.|    |.:...: |||.:....:.:...:.|..|:.|.|::: .||| .|.|:..|:|..
  Fly   360 QEALVKHLGILGFTGRK-PSLRELHRTLIKYGGWVLFPTISVLPLVL-LDPTQSATFDNFMSDSA 422

  Fly   376 RGIRFKNRLYNNPTVQQNLHSLVPFFDRKGLLEVN 410
            .|:.|:..||.|...|:.:..::|:.|.:|.|||:
  Fly   423 DGVSFRGSLYANKRCQEYIERILPWLDNRGFLEVS 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 83/302 (27%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 83/302 (27%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.