DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG33511

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:362 Identity:78/362 - (21%)
Similarity:157/362 - (43%) Gaps:45/362 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CH---------YKDEGLTITQLQINPALGPGENYGGVLTRARVEFTL-SNKEKNVQNLIVKTEID 73
            ||         .|.:.:.:...|::........|.|...:..:|..: .:|:|...|..:|:...
  Fly     9 CHLIAQRTLSVVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPR 73

  Fly    74 DDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRERMAIIFEDLSVVG 138
            .:|..:|......::.:|..:|.::|||.::..     |::::|...|...:  .::.|||:   
  Fly    74 KNEPQREECERKGVFQKESALYSQILPKIQKYA-----TKKLYPKCYYSRND--ILVLEDLT--- 128

  Fly   139 YVMADRVRRLNE----EHTHLILRKLAKFHAATAVLNERQS-GCLESYDRGFFNRYTNAYSGYFV 198
              ...|..|.||    :|..::|..|::.|||:....|::: ...|||.......:.::.:.:::
  Fly   129 --QDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYI 191

  Fly   199 GGLLAAARWMSKVPTLAHY---------GEKLFALAPHYMDIGRECFAPTPGQVNVLAHGDVWTN 254
            .||.|.....::.|   |:         .:||:.|    :....|..||:....|||.|.|.|.:
  Fly   192 TGLKAIVFLAARNP---HFQTMKAQNFIQDKLYNL----LTKAEELVAPSKTIRNVLCHRDTWDH 249

  Fly   255 NVMFKYDPNTG-RPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTET 318
            |:::.::..:. .|....::|||.:.:.||.:|:..|........:||...:...:.|:|.....
  Fly   250 NIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHH 314

  Fly   319 LEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQP 355
            |::|...:|.|.. :.|:.|.::.|..||....:.:|
  Fly   315 LDRLGLDKNLITE-NNFRKECQRTRLAALVIWALTEP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 66/300 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 65/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.