DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG5126

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:381 Identity:82/381 - (21%)
Similarity:138/381 - (36%) Gaps:74/381 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KEKNVQNLIVKTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLN----EIGDTERIFPTA 119
            :.|..:.::||.....:|. :|....|..::.|:..|.|:||....:|.    |....:...|..
  Fly    58 ERKRTEVVLVKFMKGTEEF-RESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCC 121

  Fly   120 IYV----------DRERMAIIFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHA---ATAVLN 171
            .:.          .||.: :..:.|...||.:..|: .|..:....::..:..|||   ||.:|.
  Fly   122 YFARFGHVEGLGNGRESV-LALKHLKGDGYQLGPRL-TLRRDQLEAMVGLVGPFHALGYATKILQ 184

  Fly   172 ER-----QSGCLE-----SYDRGFFN-RYTNAYSGYFV--------------GGLLAAARWMS-- 209
            ..     ::|.::     |..:|.|: .|..|:..::.              .|..||...:.  
  Fly   185 PNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREK 249

  Fly   210 --KVPTLAHYGEKLFALAPHYMDIGRECFAPTPGQVNVLAHGDVWTNNVMFKYDPNTGRPVDVL- 271
              |.|||.....:..:.|....|   ..||       ...|||...|||:|.|....  .||.: 
  Fly   250 YFKQPTLLLERIRTSSFAEDQPD---SHFA-------TFLHGDYNRNNVLFHYGAED--KVDAIK 302

  Fly   272 LIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTETLE-KLNYRQNQIPS--LH 333
            .||||...:.:..|||......:.....|::....|.:.||:...|.|| .|...:|::..  :.
  Fly   303 AIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVD 367

  Fly   334 QFKLEVEQKRF------FALHSTVVVQ---PVMISQDPTDACFNALMNDDERGIRF 380
            |...|...:||      :|.:..:|..   |.::..:...|..:.|...|..|..|
  Fly   368 QLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAF 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 69/312 (22%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 68/309 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.