DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG31300

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:418 Identity:115/418 - (27%)
Similarity:193/418 - (46%) Gaps:33/418 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIV 68
            ||.||..::||..|..:.....|.:..|:|.||...|::|..|:.|...|.|.: |.|..:.||:
  Fly    17 APAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTA-KGKFSRPLII 80

  Fly    69 KTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRE-RMAIIFE 132
            |...:.|...:::::...::..|:.:|.:|||:...:|.|.||..::|...||...| |..:|||
  Fly    81 KAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFE 145

  Fly   133 DLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYSGYF 197
            ||...||.:. |.|.:.:|.......||||:||.:....:.|...|:.:..|.|...|.....:.
  Fly   146 DLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFI 209

  Fly   198 VGGLLAAARWMSKVPTLAHYG-----------EKLFALAPHYMDIGRECFAPTPGQVNVLAHGDV 251
            ..|:.:....:.::|.|..|.           ::|.|:...|.: .|:..|     ..||.|||.
  Fly   210 TTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHE-NRKSDA-----FYVLCHGDF 268

  Fly   252 WTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFT 316
            ...|:|||.:..||...|.:|:|||.|......|||.:.....::...||:....|...|..:..
  Fly   269 HLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLV 333

  Fly   317 ETLEKLNYRQNQIPSLHQFKL--EVEQKRF--FALHSTVVVQPVMISQDPTDACFNALMNDDERG 377
            .||:.:.| ..::|:  |.||  |:.:.::  |.|.||.:  |::::........|.|:.|.|. 
  Fly   334 ATLKSIGY-PGELPT--QAKLWDEIHKNKYYDFFLLSTFL--PLILAIKSKSFKVNDLIQDPET- 392

  Fly   378 IRFKNRLYNNPTVQQNLHSLVPFFDRKG 405
               :.:.|...|..:::..|:|.|::.|
  Fly   393 ---RQKTYFLDTYVKDVSKLLPKFEQLG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 82/296 (28%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 82/296 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.