DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG31975

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:365 Identity:90/365 - (24%)
Similarity:152/365 - (41%) Gaps:49/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PGENYGGVLTRARVEFTLSNKEKNVQNLIVKTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCR 103
            ||:|||.||.........||.|...:.|:.|....|.:..| ...|......|..:|:.:.|...
  Fly    36 PGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQ-FFQPEQTCLTENAVYKILAPALA 99

  Fly   104 ELLNEIG--DTERI--FPTAIYVDRERM-----------AIIFEDLSVVGYVMADRVRRLNEEHT 153
            .|.:|.|  |..:.  || ..|..||.:           .::.|:|...|||...|::..:..||
  Fly   100 TLQDEAGVPDESQFKGFP-RFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHT 163

  Fly   154 HLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYT-NAYSGYFVGGLLAAARWMS--KVPTL- 214
            .|.|:.:|:|||.:..|...:........|.||.::. :|          .|..|.|  |..|| 
  Fly   164 LLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDWHA----------EAPEWKSVMKAETLE 218

  Fly   215 -----AHYGEKLFALAPHYMDIGRECFAPTP----GQVNVLAHGDVWTNNVMFKYDPNTGRPVDV 270
                 .:...:|.|......|...|..|..|    |....:.|.|.|.||:||:|.| ||.||::
  Fly   219 DIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINNIMFRYGP-TGTPVEL 282

  Fly   271 LLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTETLEKLNYRQNQIPSLHQF 335
            .:||||.:.:.|...|:.....:|:...:...:...:.:.|::.|...|.::..:. ::.:..:|
  Fly   283 KIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFERCLRRVGAKL-EVHTFKEF 346

  Fly   336 KLEVEQKRFFALHSTVVVQPVMISQDPTDACFNALMNDDE 375
            :|||::..:..:...:.:...:::.       :||:.|.|
  Fly   347 RLEVKRVAYIQVPHAIFMTRFILAD-------SALIGDSE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 82/312 (26%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 82/311 (26%)
APH <214..329 CDD:279908 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459337
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.