DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and E02C12.12

DIOPT Version :10

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:194 Identity:42/194 - (21%)
Similarity:70/194 - (36%) Gaps:57/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KNVQNLIVKTEID--DDELTQELMAPYDI-YNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYV 122
            |..|::|...|.|  |.|..::|...:.: .:.::.:  .||.|..:|..|.|.:|         
 Worm    24 KGFQSIIALIEPDWIDVEKGKDLPKKFAVKISTQLAL--AVLSKIMKLGGENGFSE--------- 77

  Fly   123 DRERMAIIFEDLSVVGYVMADRVRRLNEEHTHLILRKL-------AKFHAATAVLNERQSGCLES 180
                     |.|:.:|.::.|...|  |..|:.:|.|:       .|.:..        .|..::
 Worm    78 ---------EKLNELGKLIRDGHNR--EVATYKLLEKMNHPDIPYTKVYGL--------KGYSDA 123

  Fly   181 YD-RGFF-------NRYTNAYSGYFVGGLLAAARWMSKVPTLAHYG------EKLFALAPHYMD 230
            .| :||.       .|....|.......|::..|   .:.|.|..|      ||.||..|.|::
 Worm   124 NDLKGFMIMEFIPNVRSIPMYEAILADDLISLVR---GIATFAALGETLSEEEKAFAGGPEYLE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKL 39..324 CDD:397213 42/194 (22%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 42/194 (22%)

Return to query results.
Submit another query.