DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and E02C12.10

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_505430.3 Gene:E02C12.10 / 183989 WormBaseID:WBGene00017095 Length:417 Species:Caenorhabditis elegans


Alignment Length:168 Identity:39/168 - (23%)
Similarity:74/168 - (44%) Gaps:31/168 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 VLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQ 309
            ||.|||:|.:|::...| ..|......:||:|......|.:||..|....|....||::...:.:
 Worm   266 VLNHGDLWQSNMLHCLD-EFGNLKLKAIIDWQGVSTLPPGLDLSRLLMGCLSAHERRERGLEMLK 329

  Fly   310 FYHKIFTETLEKLNYRQNQIPSLHQF-KLEVEQKRFFALHSTVVVQPVMISQDPTDACFNALMND 373
            .||:.|.:.|.|         .|..| :|:.....::.:.:.:::..|....|      |:.:::
 Worm   330 LYHETFNQVLGK---------ELFSFQELQDSYNLYYPMMAMLLLPIVSSFLD------NSPISE 379

  Fly   374 DERG-IRFKNRLYNNPTVQQNLHSLVPFFDRKGLLEVN 410
            .|:. .|.||        |:|:.:::     :.|:||:
 Worm   380 VEKSQARIKN--------QKNMIAMM-----EDLIEVH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 24/78 (31%)
E02C12.10NP_505430.3 DUF1679 3..408 CDD:369592 39/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.