DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and F58B4.5

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:308 Identity:66/308 - (21%)
Similarity:128/308 - (41%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 IYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRERMAIIFEDLSVVGYVMADRVRRLNEE 151
            ::|||:..|:.::   ||...:|..| :::.:..:.|..::.         .|::::....::..
 Worm   114 LHNREVATYKILM---REKHPKIPFT-KVYASKPFDDENKLK---------AYLISEYYPNIHHI 165

  Fly   152 HTH---------LILRKLAKFHAATAVLNERQSGCLESYDRG------FFNRYTNAYSGYFVGGL 201
            ..|         .::..:|.|.|....|:|.::    .|.||      .|.::.:..|...:..|
 Worm   166 GMHESIPAEDLIPVIHAIAAFSAIGMKLSEEET----KYARGADFLDIVFGQFMDEKSIERMNVL 226

  Fly   202 LAAARWMSKVPTLAHYGEKLFALAPHYMDIGRECFAPTP-----------GQVNVLAHGDVWTNN 255
            |.|:     .|  ..|.||:..:...|.|.   .|.|..           |...||.|.|:|::|
 Worm   227 LKAS-----FP--EEYLEKVEEMLKIYKDY---YFQPQMIKNFKNTCQFFGYKPVLTHSDLWSSN 281

  Fly   256 VMFKYDPNTGRPVDV-LLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTETL 319
            .:...|   |..|.: .:||||.....:|..|:..||.:.|....||::.:.|.:.|:..|...|
 Worm   282 FLCTRD---GEKVTLKAIIDFQTVSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVNEL 343

  Fly   320 EKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVV---VQPVMISQDPTD 364
            :.::     :|...| :|:...:.:|.|.:|:|   :.|::...:.|:
 Worm   344 DGMD-----VPYTFQ-QLKDSYQVYFPLMTTMVLPGIAPMLQHSNVTE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 57/263 (22%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 66/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.