powered by:
Protein Alignment CG10514 and E02C12.8
DIOPT Version :9
Sequence 1: | NP_651371.1 |
Gene: | CG10514 / 43052 |
FlyBaseID: | FBgn0039312 |
Length: | 413 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379850.1 |
Gene: | E02C12.8 / 179320 |
WormBaseID: | WBGene00017093 |
Length: | 141 |
Species: | Caenorhabditis elegans |
Alignment Length: | 48 |
Identity: | 13/48 - (27%) |
Similarity: | 18/48 - (37%) |
Gaps: | 6/48 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 EEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNR----YTNAY 193
||.......||.||.:.|...:.|:....:...: ||. ||..|
Worm 93 EEGAGFSEEKLKKFSSLTKECHNREVDAYKVLMK--FNHPDIPYTKVY 138
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.