DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and F59B1.8

DIOPT Version :9

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:373 Identity:72/373 - (19%)
Similarity:138/373 - (36%) Gaps:75/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 THEYIEHALRCHYKDEGLTITQLQIN---PALGPGENYGGVLTRARVEFTLSNKE---------- 60
            ||..:|...:. .|::..|.::|...   ..:|.|..:...:......:|:.:..          
 Worm    18 THVTLEDVNKA-IKEQMSTESELTAESKMEVIGEGNGFSSCVILITCHWTIPSSHLPKKLILKIV 81

  Fly    61 --KNVQNLIVKTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCR-------ELLNEIGDTERIF 116
              .:||.|:.|:    :|....:|:|    ..|..::......|:       |.....|..|.:.
 Worm    82 SFVHVQGLLNKS----NEEGNSVMSP----EEEAHVHAHFEKSCQKGHNLEVEFCEAFGHLEGLL 138

  Fly   117 PTAIYVDRERMAIIFED----LSVVG--YVMADRVRRLNEEHT----HLILRKLAKFHAATAVLN 171
            ...::..::     ||:    ...||  :|....||...|..|    ..||:.||:..|    |:
 Worm   139 LPKVFFSQK-----FEEDNPNKGFVGMEFVEGSVVRHCYENVTVDELQPILKALARLQA----LS 194

  Fly   172 ERQSGCLESYDRG--FFNRYTNAYSGYFVGGLLAAARWMSKVPTLAHYGEKLFALAPHYMDIGRE 234
            .....| .:.|.|  |.....:..|...:.|:...:|.:.:     ...||:..:..::.:|   
 Worm   195 LSTESC-RNLDNGEAFEESLMDMLSEDGLKGIFDQSRNIDQ-----KLSEKVERIEQNHKEI--- 250

  Fly   235 CFAPTPGQVN--------VLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLF 291
            ....|...:|        |:.|||:|..|::  :....|..:...::|:|.|..|:|..||..|.
 Worm   251 LNLETVLNLNKVVGIDQKVICHGDLWAANIL--WTQTDGGFIADKVLDYQESHMGNPAEDLVRLL 313

  Fly   292 NTSLKEPLRRDQQNGLFQFYHKIFTETLEKLN--YRQNQIPSLHQFKL 337
            .:::....|:.....:.:.::..||:.:...|  |...|:.:  .|||
 Worm   314 VSTISGADRQSHWEHILEQFYTYFTDEIGSNNAPYTLEQLKT--SFKL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 60/325 (18%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 72/373 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.