DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and pkdc

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:399 Identity:89/399 - (22%)
Similarity:140/399 - (35%) Gaps:120/399 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DLVIKPATAKG-----------DNYASVMTRVRILFLKSGAKSPETEYYIVKTTY--ENDAFASG 92
            |||:|...||.           ..|..:: ||.:    .|...|..   :||...  :|.....|
Zfish     7 DLVLKECGAKSLQIGAKIQTLWSGYGEII-RVHL----EGCDRPSV---VVKHVMFPQNQKHPGG 63

  Fly    93 ----IFSQ-----YQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYEHEAIIFEDLAV 148
                |..|     |||.|...:.|        :..|..|.|..:.||:..   |.:.|:.|||.|
Zfish    64 WNTDISHQRKVRSYQVETYWYQNY--------TTNENCRVPLCLAAKSFG---EEQLIVLEDLDV 117

  Fly   149 TKYVLADRLVGFDLEHTRLG-------LRKLAKMHAAAAVLNERQPGLLTKFDHGIF-NRHTQAF 205
                     .||.:..|.:.       |..:|..|  |..|:....||   :..|.: :..|:  
Zfish   118 ---------AGFPVRKTYVNDAEIKACLSWIANFH--ALFLDVTPEGL---WPIGTYWHLETR-- 166

  Fly   206 APFFVNTVGVAADFARECPELGERYATKLKKLQERVMEYSTRVYDPQPGDFNTLVHGDYWVNNVM 270
                              ||  |..|...:||:....|..:.:.:.:   |.|:||||..:.|..
Zfish   167 ------------------PE--ELEAMSDQKLKAAAGEIDSILNNCR---FKTIVHGDAKLANFC 208

  Fly   271 LRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHTVLVETL-KDL 334
            .    :|:.|.:..:|||:........|:.||..:.:......::...|..||.:.|.::| |.:
Zfish   209 F----SKDGLQVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYYFSELRKSLEKKV 269

  Fly   335 NFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNADADFNALMKDDERGRNFRKVLYTNK 399
            :|.         .|:.|....||.               |..||:..:.....|.:  |:...:|
Zfish   270 DFA---------ELEKEWRNMFAF---------------AWTDFHRFLLGWMPGHH--KINKYSK 308

  Fly   400 RL-QDNLKR 407
            || |:.||:
Zfish   309 RLTQEVLKK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 68/316 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.