DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG10550

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:434 Identity:143/434 - (32%)
Similarity:211/434 - (48%) Gaps:62/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PEWLDETYLERLL-RDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRI-LFLKSGAKSPETEYY 78
            |:|::|.|.:.:: :|::|..  :|.:||...|||.|:||.|:|.||.: :.||.|  |.:...|
  Fly    20 PKWINEEYFQPIIEKDVENFD--KIINLVPIAATAPGENYTSIMIRVIVDILLKDG--SEQRVSY 80

  Fly    79 IVKTTYENDAFAS-----GIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYEH 138
            |:||..|.|:.|.     |:|.:      |.:|||..:||...|.::.....::..|.||||...
  Fly    81 ILKTMLEADSGADVIDGMGLFPK------ERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATD 139

  Fly   139 EAI--IFEDLAVTKYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTKFDHGIFNRH 201
            |.|  :||||:...:...|||.||||.|.|..|||||::|||:.|..|........::..|:|..
  Fly   140 ELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQ 204

  Fly   202 TQAFAPFFVNTVGVAADFARECPE-LG-ERYATKLKKLQ----ERVMEYSTRVYDP--------- 251
                              :|:..| || :|....||.::    |....|..|::||         
  Fly   205 ------------------SRDLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQ 251

  Fly   252 ----QPGDFNTLVHGDYWVNNVMLRYGENKEPLDMT-LIDFQFCSWSSPAVDLHYFFNTSVQVDI 311
                ...:||.|.|||.|.||:|..|.:|.| :|.| |:|.|...|.|||.||.|...||..:||
  Fly   252 VNQVDEDEFNVLNHGDCWSNNIMFNYKDNGE-IDRTILVDLQVGKWGSPAQDLWYLITTSASLDI 315

  Fly   312 RYEQQDALFQYYHTVLVETLKDLNFGGYIPTLRQF-VLQLERGRFFAVT-VALVCQAILTNDQNA 374
            :.::.|...|.||..|.|.||.||:...|||||.. ::.|:.|.:..:| :.::...::..|:  
  Fly   316 KIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDK-- 378

  Fly   375 DADFNALMKDDERGRNFRKVLYTNKRLQDNLKRELPRFDRSGLL 418
            ||:...::.........|...:.|......:|..||.||..|||
  Fly   379 DANMKMILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 109/313 (35%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 109/313 (35%)
APH 108..338 CDD:279908 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.