DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG31370

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:432 Identity:130/432 - (30%)
Similarity:207/432 - (47%) Gaps:78/432 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PEWLDETYLERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRILFLKSGAKSPETEYYIV 80
            ||||:|.::..:||..:.:|.||:|.|...|.:|||||||||:.|.|:.::..  |...::..|:
  Fly    13 PEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ--KGFFSKSLII 75

  Fly    81 KTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYE-HEAIIFE 144
            ||..|..| .|.:|.      ||:.||.|:||:.:.::.:.....:::|:.::...| .:.:|||
  Fly    76 KTVLEMFA-GSALFK------TEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFE 133

  Fly   145 DLAVTKYVLA-DRLVGFDLEHTRL--GLRKLAKMHA-AAAVLNERQPGLLTKFDHGIFNRHTQAF 205
            ||....|.:. ||:    |.|..:  ...||||.|| :..::||| |..:.:|..||    ....
  Fly   134 DLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINER-PEFVKEFKDGI----CLVD 189

  Fly   206 APFFVNTVGVAADFARECPELGERYATKLKK--------LQERVMEYSTRVYDPQPGDFNTLVHG 262
            .|:..:.:|...||....||| :||.|..:|        |::.:.||.|   :|||| :..|.||
  Fly   190 IPYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEYQT---NPQPG-YYVLCHG 249

  Fly   263 DYWVNNVMLRYGENKEP---LDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYH 324
            ||...|:|:::  |||.   .|..|:|:|.|..:..|.||.|.....:..:.|..:.:.|..||.
  Fly   250 DYHTRNIMVKH--NKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYF 312

  Fly   325 TVLVETLKDLNFGGYIPTLRQFVLQLER---------GRFFAVTVALVCQAILTNDQNADADFNA 380
            :||.|||:.:.:.|.:|....|..::.|         ..:..::|.|..:. .||::        
  Fly   313 SVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLET-ATNEE-------- 368

  Fly   381 LMKDDERGRNFRKVLYTNKRLQD---NLKRELPRFDRSGLLD 419
                            |:.:|||   ..|..|.||:|||..:
  Fly   369 ----------------TDDKLQDFIEECKSILARFERSGYFE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 97/301 (32%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 97/301 (32%)
APH <202..320 CDD:279908 44/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459578
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.