DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG13659

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:438 Identity:128/438 - (29%)
Similarity:210/438 - (47%) Gaps:42/438 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEQGKEDATEFHPAPEWLDETYLERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRILF 65
            |.|:...| .|.:| ||||:..::.::||..:.|..|::.:|...||:||||:|||:|.|.|:.:
  Fly     1 MAEESFND-DELNP-PEWLNVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRARVEY 63

  Fly    66 LKSGAKSPETEYYIVKTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAK 130
            .......  |:..|:||....:.....:|....:.|||:.||.|:||:...::.:...|.|::.:
  Fly    64 TAQNGNF--TKSLIIKTMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWERILRRANDPAKLYVE 126

  Fly   131 TL-HVDYEHEAIIFEDLAVTKY-VLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTKF 193
            .: |....|:.:||:||....| |:.||.:  ..|.......||||:||.:......||..|.:|
  Fly   127 CIYHSLQPHQILIFDDLVEMGYAVVRDRFL--TREEISSAYSKLAKIHAISMKFIHEQPEYLKEF 189

  Fly   194 DHGIFNRHTQAFAPFFVNTVGVAA------DFARECPELGERYATKLKK--------LQERVMEY 244
            .:|:..      .|..:::..::.      :.....||| .:|....||        |:|.:.||
  Fly   190 KNGLCE------MPGLIDSSIISGGMDPFMEMLGRIPEL-SKYQPHFKKISLHFKDRLRETMQEY 247

  Fly   245 STRVYDPQPGDFNTLVHGDYWVNNVMLRYGENKEP---LDMTLIDFQFCSWSSPAVDLHYFFNTS 306
            ..   :|||| :|.|.|.|:...|:|.:  .|||.   .|..|:|:|.|:.:..||||.|.....
  Fly   248 RN---NPQPG-YNVLCHADFHSRNMMFK--NNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYML 306

  Fly   307 VQVDIRYEQQDALFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTND 371
            :....|.|:.|.|..||.::|:||||.:.:.|.:||.:.|..:::|.|::...:......:....
  Fly   307 MGPAQRREELDILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSIGL 371

  Fly   372 QNADADFNALMKDDERGRNFRKVLYTNKRLQDNLKRELPRFDRSGLLD 419
            :....|...:|.::|.    ||.||..:...:..|..|.||.:||..|
  Fly   372 RTHKLDIGDMMHNEET----RKKLYQLEDFMEETKSILDRFQKSGYFD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 91/304 (30%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 91/304 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.