DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG14314

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:386 Identity:90/386 - (23%)
Similarity:163/386 - (42%) Gaps:46/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DPGLRITDLVIKPATAKGDNYASVMTRVRILFLKSGAKSPET-------EYYIVKTTYENDAFAS 91
            :|.::|....:...:.:||||.:.:.|:::...:...|..:.       |..:.:..|::|    
  Fly    39 EPDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQNVICKVMPESVVAREAYKSD---- 99

  Fly    92 GIFSQYQVSTTEMRMYEKILPQLSSL-IEKTRQPEKVF-AKTLHVDYEHEAIIFEDLAVTKYVLA 154
                  ::...|::.|..|:|:|... ..||.|...|| |........|:.:|.|||....:.::
  Fly   100 ------KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARHDLLIMEDLRERGFQMS 158

  Fly   155 DRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQP----GLLTKFDHGIF-NRHTQAFAPFFVNTVG 214
            ||..|..||.|:..|.::|::|..:......:|    .|.:....||| ..:|..:..::.....
  Fly   159 DRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYYERLTK 223

  Fly   215 VAADFARECPELGERYATKLKKLQE------RVMEYSTRVYDPQPGDFNTLVHGDYWVNNVMLRY 273
            .|.....|......:|...:.|..|      |:::.::     .....:.:.|||.||||.:..|
  Fly   224 NAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLAS-----TESPLSAICHGDCWVNNFLYHY 283

  Fly   274 GENKEP---LDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHTVLVETLKDL- 334
             :.::|   |::.|:|||...:||.|:|:..........::|..|...|.:.|...|...|:.| 
  Fly   284 -DPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLC 347

  Fly   335 -NFGGYIPTLRQ----FVLQLERGRFFAVTVALVCQAILTNDQNADADFNALMKDDERGRN 390
             |...:..||::    |..:|:....||:.:||....|.| ..:.||....|.:.||.|.:
  Fly   348 TNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPIST-CSSEDAPDMYLDRSDELGED 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 71/310 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 70/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.