DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG33509

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:387 Identity:91/387 - (23%)
Similarity:142/387 - (36%) Gaps:117/387 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DNYASVMTRVRILFLKSGAKSPETEYYIVKTTYENDAFASGIFSQYQVST-----------TEMR 105
            :|......||::|           :|::|:     |..|.|....|...|           .|:.
  Fly    12 ENAQESAVRVKLL-----------DYHLVR-----DLSAIGYLGDYYALTLRYCHEEEEIIREIE 60

  Fly   106 MYEKILPQLSSLIEKTRQPEKVFAK------TL--------HVDYEHEAIIF-EDLAVTKYVLAD 155
            ::.|.:||.|:.:.|    |.:|.|      ||        :|.:....:.. :||.|.:.:   
  Fly    61 LFVKAMPQQSAELSK----ESIFQKESWLYDTLIKKLQALSNVKWSPNCVYSRKDLMVLENI--- 118

  Fly   156 RLVGFDLEHTRLG------------LRKLAKMHAAAAVLNERQPGLLTKFDHGIFNRHT------ 202
            :|.||    |..|            ::.:|..|:|:.|...:     ||.:.|    ||      
  Fly   119 KLKGF----TSAGSAELNEVFVKPLIKSIAAFHSASLVYEHQ-----TKTNIG----HTYGDNLL 170

  Fly   203 -----QAFAPFFVNTVGVAADFA-----------RECPELGERYATKLKKLQERVMEYSTRVYDP 251
                 ...|.|   |.|::|..|           ||...:|:    ||..:.|.:.|.:.    |
  Fly   171 EITVDSEIAWF---TTGLSAVLAVVRSLAKYQGNREQSFIGD----KLMGIMETIYEQAA----P 224

  Fly   252 QPGDFNTLVHGDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQ 316
            .....|.|.|.|.|..|:... .||..|  ..|||||.|.::.||.||::....::....|.:.:
  Fly   225 SKKYRNVLCHRDIWAGNIFFP-PENSGP--ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQME 286

  Fly   317 DALFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFF-------AVTVALVCQAILTND 371
            ......|||.|::.|.||.....:.:..:.:...|..|.|       |.||..|....:|||
  Fly   287 KQGIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITND 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 81/343 (24%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 68/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459515
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.