DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG33511

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:361 Identity:72/361 - (19%)
Similarity:147/361 - (40%) Gaps:43/361 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DETYL--ERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRILFLKSGAKSPETEY---YI 79
            :|.:|  :|.|..:|.|..:.|...|    .|...:....|.....|.|::..|..:.:|   |.
  Fly     7 EECHLIAQRTLSVVKKDNVILINSQV----DAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYF 67

  Fly    80 VKT------TYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYEH 138
            :|:      ....:....|:|.:      |..:|.:|||::.....|...|:..:::       :
  Fly    68 IKSLPRKNEPQREECERKGVFQK------ESALYSQILPKIQKYATKKLYPKCYYSR-------N 119

  Fly   139 EAIIFEDLAVT-KYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQ-PGLLTKFDHGIFNRH 201
            :.::.|||... :::.|:..  :.|:|.::.|..|:::|||:....|:: ..:...:.:.:...|
  Fly   120 DILVLEDLTQDYRHLRANEY--YTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELH 182

  Fly   202 TQAFAPFFVNTVGVAADFARECPELGERYATKLKKLQERVMEYSTRVYD---PQPGDFNTLVHGD 263
            ..:...:::..:......|...|......|...  :|:::....|:..:   |.....|.|.|.|
  Fly   183 LDSNNSWYITGLKAIVFLAARNPHFQTMKAQNF--IQDKLYNLLTKAEELVAPSKTIRNVLCHRD 245

  Fly   264 YWVNNVMLRYGENKE----PLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYH 324
            .|.:|::  |..|||    |....::|||...:.||.:|:.:........::|....|...::|:
  Fly   246 TWDHNIV--YYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYY 308

  Fly   325 TVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTV 360
            ..|...|..|.....:.|...|..:.:|.|..|:.:
  Fly   309 KNLQHHLDRLGLDKNLITENNFRKECQRTRLAALVI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 58/303 (19%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 57/296 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.