DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG31974

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:390 Identity:96/390 - (24%)
Similarity:164/390 - (42%) Gaps:71/390 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TDLVIKPATAKGDNYASVMTRVR---------ILFLKSGAKSPETEYYIVKTTYENDAFASGIFS 95
            |..:.||    ||||.|:|..|:         |..|...||.|         ...||.:.. ||.
  Fly    29 TSYLTKP----GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLP---------PLTNDLYWQ-IFQ 79

  Fly    96 QYQVSTTEMRMYEKILPQLSSL-IEKTRQPEKVF-------AKTLHVD-----YEHEAIIFEDLA 147
            ..:...||..:|:.:.|:|..| :|....|.::|       ...:.:|     .:.:|::.::..
  Fly    80 PERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENV 144

  Fly   148 VTK-YVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGL--------LTKFD--HGIFNRH 201
            .|: |...:|...::|..|.|.|..||:.||....|..::|.:        ..|||  ..|....
  Fly   145 TTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAE 209

  Fly   202 TQAFAPFFVNTVG-VAADFARECPELGERYATKLKKLQE--RVMEYSTRVYDPQPGDFNTLVHGD 263
            |:......:..:. |.:|         ||...::|:|.:  :..:.|..|.|   |.|.||||||
  Fly   210 TEIMNKEILKDIKLVTSD---------ERDVNRVKELLDIFQAFQASNDVDD---GPFTTLVHGD 262

  Fly   264 YWVNNVMLRY---GENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHT 325
            .|:||:||:|   ||...||.:.::|||...:.|...|:.:...:||.|::..:........|:.
  Fly   263 LWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYN 327

  Fly   326 VLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNA------DADFNALMKD 384
            ..::||:.:|......|...|:.::::.....:..|:....::..|.:.      |.||:.|.|:
  Fly   328 AFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVLTKN 392

  Fly   385  384
              Fly   393  392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 83/324 (26%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 84/327 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.