DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG7135

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:434 Identity:114/434 - (26%)
Similarity:199/434 - (45%) Gaps:41/434 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DATEFHP---APEWLDETYLERLLRDLKNDP-GLRITDLVIKPATAKGDNYASVMTRVRILFLKS 68
            ||.|..|   .|::...| ||..|:.|.... |:::|:|     |..|:||.|.:.|.:|.:..:
  Fly     3 DALEEPPLYLTPQFFRRT-LEHGLQQLDLQVIGVQLTNL-----TRGGENYCSNIYRAQIKYRNA 61

  Fly    69 GAKSPETEYYIVKTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEK--------TRQPE 125
            .:.:.||...:.....|..|    |.::..:...|...|..|.|:|.:|:.:        |..|:
  Fly    62 ESCAMETSLIVKSMPDEKQA----ILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPK 122

  Fly   126 KVFAKTLHVDYEHEAIIFEDLAVTKYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQP-GL 189
            ..::.|    ...:.||.|||....|.|..|.:|.|.:|..|.:.|||:.||...|:.||:| .:
  Fly   123 HYYSTT----QPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETI 183

  Fly   190 LTKFDHGIFNR---HTQAFAPFFVNTVGVAADFARECPELGERYATKLKKLQERVMEYSTRVYDP 251
            :.::..|:.:.   :::.|...|...:...|....:|...| ...|||.:..|...|...:...|
  Fly   184 VDRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFG-GITTKLYRYHEHFTERVLKAVYP 247

  Fly   252 QPGDFNTLVHGDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQ 316
            ..|:.|.|.|||.||||:..:|........:.:||||.|.:.|...|::||.|||:::::..:::
  Fly   248 LRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRR 312

  Fly   317 DALFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVA-----LVCQAILTNDQNADA 376
            ..|...|:..||:.||.|.:...:|:....:.::.:...:...||     |:....:.::.|:..
  Fly   313 QELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLK 377

  Fly   377 DFNALMKDDERGRNFRKVLYT-NKRLQDNLKRELPRFDRSGLLD 419
            :|:    |:...|...::::. |.|..::||..|.|.|...|.|
  Fly   378 NFH----DETFARQKVQLMFEGNTRTLESLKCTLKRLDELKLFD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 83/297 (28%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 82/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459190
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
98.860

Return to query results.
Submit another query.