DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and CG32195

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:417 Identity:127/417 - (30%)
Similarity:206/417 - (49%) Gaps:47/417 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YLERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRILFLKSGAKSPETEYYIVKTTYEND 87
            |.||.|........||:.:..||..:.||:|:.||:.||.::|.:|...:.|:..||:|......
  Fly    10 YFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKDLLPAA 74

  Fly    88 AFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQ---PEKVFAKTLHVDYE--HEAIIFEDLA 147
            |         .:.|.|..|:|.:||.:.:::|:..:   ..|:.|..|.|:..  .|..|.|||.
  Fly    75 A---------ALGTNEKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLG 130

  Fly   148 VTKYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTK-----FDHGIFNRHTQAFAP 207
            ...|...||..|.:||..::.:||||:.|.|:.||.|::|.|:.:     :.:|:.:|..||.. 
  Fly   131 ALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDRFAQALV- 194

  Fly   208 FFVNTVGVAAD-FARECPELGERYATKLKKLQERVMEYSTRVYDPQPGDFNTLVHGDYWVNNVML 271
              :.....||: ||.|.||:.::...::.|...:.|.   .|.||.....|.::|||.|:||:|.
  Fly   195 --LEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMR---DVVDPNKSSLNAVIHGDPWLNNIMF 254

  Fly   272 RYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHTVLVETLKDLNF 336
            .:...|    .||:|||.|.|.|||:||::.|.||::.::....||.|..||...|:|||:...:
  Fly   255 DFVNKK----ATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFDNLLETLRHCGY 315

  Fly   337 GGYIPTLRQFVLQLERGRFFAVTVALVCQ-AILTNDQNADADF--------NALMKDDERGRNFR 392
            ...:||..|...:::|..|:.. ..:||: .|......|..||        :|::|.       |
  Fly   316 KDTLPTFGQLKDEMKRCLFYGY-YTVVCELPICCASPEASVDFGVHTFVDTDAMLKK-------R 372

  Fly   393 KVLYTNKRLQDNLKRELPRFDRSGLLD 419
            ..|:.::|::..:|..|..|||.|:|:
  Fly   373 HQLFASERVRQTIKATLLMFDREGILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 96/296 (32%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 96/296 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449897
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4082
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.