DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and H37A05.2

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:283 Identity:65/283 - (22%)
Similarity:119/283 - (42%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYEHEAIIFEDL-AVTKYVLADRLVGFDL 162
            |:...:..:.::.|..:.:|.:       :...||....::.|..|:: ||...:.|...:|..:
 Worm   134 VNVLSLEAFTELSPLKAYIISE-------YIPNLHHVGMNDCISIEEIWAVVDGIAAFSAMGESM 191

  Fly   163 EHTRLGLRKLAKMHAAAAV---LNERQPGLLTKFDHGIFNRHTQAFAPFFVNTVGVA-ADFAREC 223
            .........:.:::...||   .:::.|..:.|               ..:..:||| .:...|.
 Worm   192 SEDEKKKSTIGEIYIEEAVKYFFDDQSPDNMRK---------------NLIMILGVAYEEKVEEA 241

  Fly   224 PELGERY--ATKLKKLQERVMEYSTRVYDPQPGDFNTLVHGDYWVNNVMLRY-GENKEPLDM-TL 284
            .::.:.|  :::::|...||..:.        |....|:|.|.|.:|::... .|||  |:. .|
 Worm   242 MDIFDLYCGSSEIQKNYSRVSAFL--------GHSPVLMHSDIWPSNLLFSLSSENK--LEFKAL 296

  Fly   285 IDFQFCSWSSPAVDLHYFFNTSV-QVDIRYEQQDALFQYYHTVLVETLKDLNFGGYIPTLRQFVL 348
            ||||..|.|||.:|:.....|.: :.|.|..|.:.|.:||.: .|::||..|   .||..|:   
 Worm   297 IDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQSEILDRYYKS-FVKSLKTPN---SIPYTRE--- 354

  Fly   349 QLERG--RFFAVTVALVCQAILT 369
            |||..  ..|..:|.|:...||:
 Worm   355 QLEDSYELCFPASVILMLPFILS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 53/246 (22%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 65/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4082
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.