DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and E02C12.8

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001379850.1 Gene:E02C12.8 / 179320 WormBaseID:WBGene00017093 Length:141 Species:Caenorhabditis elegans


Alignment Length:149 Identity:36/149 - (24%)
Similarity:60/149 - (40%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FHPAPEWLDETYL--ERLLRDLKNDPGLRITDLVIKPATAKGDNYASVMTRVRIL-----FLKSG 69
            :.|| :.:.||::  |.:.:||:...|.|.|....|.||...| ....|:|:..|     .::.|
 Worm     4 YEPA-DGILETHVTWEDVEKDLQQSLGTRATFGENKRATNISD-LKGFMSRIACLEPDWQNIEEG 66

  Fly    70 AKSPETEYYIVKTTYENDAFASGIFSQYQ-VSTTEMRMY-------EKILPQLSSLIEKTRQPE- 125
            .:.|             ..||..|.||.. |:.:::..:       |:.|.:.|||.::....| 
 Worm    67 KELP-------------SKFALKISSQLALVALSKIMNFEEGAGFSEEKLKKFSSLTKECHNREV 118

  Fly   126 ---KVFAKTLHVDYEHEAI 141
               ||..|..|.|..:..:
 Worm   119 DAYKVLMKFNHPDIPYTKV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 23/109 (21%)
E02C12.8NP_001379850.1 PKc_like 3..>141 CDD:419665 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.