DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10513 and F59B1.8

DIOPT Version :9

Sequence 1:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:152 Identity:28/152 - (18%)
Similarity:55/152 - (36%) Gaps:33/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 DFNTLVHGDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDAL 319
            |...:.|||.|..|::....:.....|..| |:|.....:||.||.....:::....|....:.:
 Worm   266 DQKVICHGDLWAANILWTQTDGGFIADKVL-DYQESHMGNPAEDLVRLLVSTISGADRQSHWEHI 329

  Fly   320 FQYYHTVLVE---------TLKDL--NFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQN 373
            .:.::|...:         ||:.|  :|..|.|.....::.|     |...|.:..|.:      
 Worm   330 LEQFYTYFTDEIGSNNAPYTLEQLKTSFKLYFPVGALTLISL-----FGPAVDMKLQGM------ 383

  Fly   374 ADADFNALMKDDERGRNFRKVL 395
                      :..:..|:|:::
 Worm   384 ----------ESGKAENYRRIV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 19/91 (21%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.