DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and pkdc

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:201 Identity:43/201 - (21%)
Similarity:73/201 - (36%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 ERDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNK 199
            |...|:.||:.:..:.|  |:..::.......|..:|.|||           :|......|.:..
Zfish   106 EEQLIVLEDLDVAGFPV--RKTYVNDAEIKACLSWIANFHA-----------LFLDVTPEGLWPI 157

  Fly   200 HTRAYAPIMTNLLEALSRSLASDEELGQRYKA---KIDRLVERLMDYGERSTTSSPGDFLTLAHG 261
            .|..:.......|||:|         .|:.||   :||.::....             |.|:.||
Zfish   158 GTYWHLETRPEELEAMS---------DQKLKAAAGEIDSILNNCR-------------FKTIVHG 200

  Fly   262 DLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRL 326
            |....||.|..|..:    ...:|||:........|:.||..:.:.:....:....|:.:|:..|
Zfish   201 DAKLANFCFSKDGLQ----VASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYYFSEL 261

  Fly   327 TEALRK 332
            .::|.|
Zfish   262 RKSLEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 43/201 (21%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 42/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.