DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG18765

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:439 Identity:100/439 - (22%)
Similarity:176/439 - (40%) Gaps:95/439 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVWLTS---EYVQDKLRTYFKDSSL--KLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQS 72
            |.|:..   |.:..::..:.|..||  |..|...:||:.           ::::.....:| |:.
  Fly    17 PTWVEKKELEALVKQISEFRKIESLRWKWETQLAEPALC-----------VHIQVLVADNK-KRQ 69

  Fly    73 TTFLVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRERD 137
            .::|:|:  .:..|.|..|...|.::.|..::|.:||.|.::.:.  .|....|...:...:.:.
  Fly    70 VSYLIKS--PETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQN--SDRIVHFGPPVIQAKLKS 130

  Fly   138 SIIFEDMSLDH-YKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKHT 201
            |.|:.|..|:. |.||...|.|.:.....||.|||.:||.::....:.||...:           
  Fly   131 SHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRE----------- 184

  Fly   202 RAYAPIMTNLLEALSRSLASDEELGQ-------------------RYKAKIDRLVERLMDYGERS 247
                      |..|..:..||||..:                   :|:.|    |:....|.:..
  Fly   185 ----------LPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDK----VKSFQKYVKSG 235

  Fly   248 T--TSSPGDFLTLAHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSL---- 306
            |  ..|...|..:.:|..|..|.:.|.||..:..:.:|..|..:.:.....||   ||:.|    
  Fly   236 TEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDL---FSSLLTAPA 297

  Fly   307 QDNLRLEHQTELVQFYYYRLTEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYE- 370
            :.:.|.:   ..|:||:.:|.|.|..||:.|:.|||.|.||.....|.:|...:....|::..: 
  Fly   298 EKSSRFD---GYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSDF 359

  Fly   371 GKEDASIEQVLSSSESGMRFKNSVYESENIKKKLSVTLPFLDQFGLLDD 419
            |..|  ||::         |:|.|: .|.|::    .||:::..|..::
  Fly   360 GNND--IEEL---------FRNPVF-GEQIRE----LLPWMENRGYFEE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 67/313 (21%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 67/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.