DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG31370

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:422 Identity:118/422 - (27%)
Similarity:187/422 - (44%) Gaps:48/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTEKSTHKVHPAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTK 65
            |.|.|.......|.||..::|.|.||::.|:..|::..||..|..|.|.||.||:.|..|||.|:
  Fly     1 MAEDSLADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ 65

  Fly    66 VSKGKQSTTFLVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATM 130
              ||..|.:.::||..       ::.....::..|:.:|..:||:.|.::| |..|:.:|:|..:
  Fly    66 --KGFFSKSLIIKTVL-------EMFAGSALFKTEIGMYRKVLPEFARILR-ENNDTSRLYAECI 120

  Fly   131 NVDRERDSI-IFEDM-SLDHYKVACRRKKLDLEHTHL--VLEKLALFHAASSVLAERQPGIFDKN 191
            ....|...: ||||: .:|:..|..|    .|.|..:  ...|||.|||.|..:...:|. |.|.
  Fly   121 YYSLEPSQVMIFEDLGEMDYAMVRDR----VLTHGEICGAYSKLAKFHALSMKIINERPE-FVKE 180

  Fly   192 YDRGFFNKHTRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDRL----VERLMD-YGERSTTSS 251
            :..|.    .....|.|::.:......|....|| .|||...:::    ::||.| ..|..|...
  Fly   181 FKDGI----CLVDIPYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEYQTNPQ 240

  Fly   252 PGDFLTLAHGDLWTTNFMFQYDAKEHP--TNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEH 314
            || :..|.|||..|.|.|.::: ||..  .:.:.:|:|.......|.||.|.....:....|:..
  Fly   241 PG-YYVLCHGDYHTRNIMVKHN-KESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303

  Fly   315 QTELVQFYYYRLTEALRKLKYAGRIPS----------LFDFQLQFRSRGFYAVFCSLIFEPVMQY 369
            ...|:.:|:..|.|.|||:.|.|::|.          |.|::..|.|. :..:...|..|.....
  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLST-YLPMSVGLSLETATNE 367

  Fly   370 EGKEDASIEQVLSSSESGM-RFKNSVYESENI 400
            |  .|..::..:...:|.: ||:.|.| .||:
  Fly   368 E--TDDKLQDFIEECKSILARFERSGY-FENL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 84/298 (28%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 84/298 (28%)
APH <202..320 CDD:279908 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.