DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG14314

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:404 Identity:91/404 - (22%)
Similarity:161/404 - (39%) Gaps:56/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTSEYVQDKLRTYFK--DSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV- 77
            |:.|..||    .||  :..:::...:.......|.||.:.:.||.:....:..|.:|:....| 
  Fly    26 LSLEVFQD----IFKHVEPDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQNVICKVM 86

  Fly    78 -KTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRER-DSII 140
             ::..|......|.|     :..|:..|..|:|:|......:......:|.|.......| |.:|
  Fly    87 PESVVAREAYKSDKL-----FRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARHDLLI 146

  Fly   141 FEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQP------------GIF---DK 190
            .||:....::::.|.|.|.||.|..||.::|..|..|......:|            |||   :.
  Fly   147 MEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANT 211

  Fly   191 NYDRGFFNKHTRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYG---ERSTTSSP 252
            ::.|.::.:.|:       |.::.:|..|..|    .:|...:::..|....:|   :.::|.||
  Fly   212 SWYRNYYERLTK-------NAIQMVSEVLPPD----SKYVLAMNKFAESSSFFGRMVKLASTESP 265

  Fly   253 GDFLTLAHGDLWTTNFMFQYDAKEHPTNAI---FIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEH 314
              ...:.|||.|..||::.|| .|.|...:   .:|||...::|.|:|:...........:|...
  Fly   266 --LSAICHGDCWVNNFLYHYD-PEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQ 327

  Fly   315 QTELVQFYYYRLTEALRKL-----KYAGRIPSLFD-FQLQFRSRGFYAVFCSLIFEPVMQYEGKE 373
            ...|::.|...|...|:.|     .:...:..|.| |..:.::.|.:|:..:|...|:... ..|
  Fly   328 LQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPISTC-SSE 391

  Fly   374 DASIEQVLSSSESG 387
            ||....:..|.|.|
  Fly   392 DAPDMYLDRSDELG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 72/316 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 71/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.