DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG6830

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:418 Identity:107/418 - (25%)
Similarity:203/418 - (48%) Gaps:21/418 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTR--INVEYTTKVSKGKQSTTF 75
            |.||.....::.|.... |...|:.....|||:|.|.||.::|.|  |:||.|.|.:|   ..:|
  Fly    47 PKWLNQTQFEELLAADV-DQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTK---LVSF 107

  Fly    76 LVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRK---ELKDSRKLFAATMNVDRE-- 135
            ::|... |......::.....:|.|...|..|||::.::.:.   ::|.:.:.|  .::..:|  
  Fly   108 MMKVPH-DTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAF--KLDATKEPK 169

  Fly   136 -RDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNK 199
             .::::..|:..:.:|...|.:.|:||.|...|.:||.||||.:.:.:.. |.:...:..|....
  Fly   170 VANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVH-GPYPDIFVNGVMGN 233

  Fly   200 HTRAYAPIMTNLLEALSRSLASDEEL---GQRYKAKIDRLVERL-MDYGERSTTSSPGDFLTLAH 260
            :..|....|..:|.:...|..::.:.   |:.|:.|:::.:..| |::.:.... .|.:|..|.|
  Fly   234 NKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIV-DPNEFNALNH 297

  Fly   261 GDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYR 325
            ||.|..|.:|:.::.....:.:|:|||...:.|||:||.||..:|:|.:.:|.|....::.|...
  Fly   298 GDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEA 362

  Fly   326 LTEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSESGMRF 390
            |.:.|..|.:.||.|||.:........|.:.:|.::...|::..:..:.|:.:..:|.|..|:.|
  Fly   363 LVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSADGVSF 427

  Fly   391 KNSVYESENIKKKLSVTLPFLDQFGLLD 418
            :.|:|.::..::.:...||:||..|.|:
  Fly   428 RGSLYANKRCQEYIERILPWLDNRGFLE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 76/299 (25%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 76/299 (25%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.