DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG33509

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:307 Identity:69/307 - (22%)
Similarity:123/307 - (40%) Gaps:62/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 REMDIYEHILPQLADMVRKE--------LKDSR-KLFAATMNVD-------RERDSIIFEDMSLD 147
            ||::::...:||.:..:.||        |.|:. |...|..||.       ..:|.::.|::.|.
  Fly    57 REIELFVKAMPQQSAELSKESIFQKESWLYDTLIKKLQALSNVKWSPNCVYSRKDLMVLENIKLK 121

  Fly   148 HYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKHTRAYAPIMTNLL 212
            .: .:....:|:......:::.:|.||:||.|...:........|.               .|||
  Fly   122 GF-TSAGSAELNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYG---------------DNLL 170

  Fly   213 E------------------ALSRSLASDEELGQRYKAKI-DRLVERLMDYGERSTTSSPGDFLTL 258
            |                  |:.||||..:  |.|.::.| |:|:..:....|::..|.....: |
  Fly   171 EITVDSEIAWFTTGLSAVLAVVRSLAKYQ--GNREQSFIGDKLMGIMETIYEQAAPSKKYRNV-L 232

  Fly   259 AHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYY 323
            .|.|:|..|..|   ..|:...|:.||||...:..||.||::....:|..:.|.:.:.:.:..|:
  Fly   233 CHRDIWAGNIFF---PPENSGPALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYH 294

  Fly   324 YRLTEALRKLKYAGRIPS---LFDFQLQFRSRG--FYAVFCSLIFEP 365
            ..|.:.|..|.....:.|   |.:...:||..|  :.||..:::..|
  Fly   295 TYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 61/270 (23%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 58/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459487
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.940

Return to query results.
Submit another query.