DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG33510

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:382 Identity:81/382 - (21%)
Similarity:142/382 - (37%) Gaps:102/382 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LDTKPAVANGGNYGSVMTRIN-VEYTTKVSKGKQSTTFLVKTTFADRDPAGDVLIHYGV-----Y 97
            :.|:|       |..|.||.| .|..|.....|     ::....||::..| ||:::.:     :
  Fly     1 MSTEP-------YSPVFTRENRTELFTLEECNK-----ILANLLADKNEQG-VLLNFNIVPATEH 52

  Fly    98 TREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRERDSIIFEDMSLDHY--KVACRRKKLDL 160
            |..:..|.|:..|.....:|:::.|| ||.         .|:||::.:::.|  |:....|::.|
  Fly    53 TGFLGEYFHLYFQYQLEDQKDVQTSR-LFV---------KSVIFQNANMEFYMEKMGLIEKEIKL 107

  Fly   161 EHTHLVLEKLALFH----AASSVLAERQPGIFDKNYDRG---------FFNKHTRAYAPIMTNLL 212
               :.:|.:|..|.    :|......:...:.....|.|         |.|::  ...||:.:|.
  Fly   108 ---YDLLNELKKFSKHVWSAKCYFTRKDLFVMQNVEDMGYVALPPGTRFLNEN--QMGPILKSLA 167

  Fly   213 EALSRSLASDEELGQRY---------KAKIDRLVE------------------------------ 238
            ...:.|:|.:::.|:..         :..:|..||                              
  Fly   168 TLHASSIAYEKQQGKTIGVEFRKWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNPEAQEYIA 232

  Fly   239 ----RLMDYGERSTTSSPGDFLTLAHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLH 299
                |.:|........||.......|.|.|..| :|.:..|.|...:|.:|||...::.||:|.|
  Fly   233 QELPRCLDKVYCMVNPSPVHRNVFVHRDAWNAN-VFYHKEKPHEERSILVDFQLCRYSPPAMDFH 296

  Fly   300 YFFSTSLQDNLRLEHQTELVQFYYYRLTEALRKL---KYAGRI------PSLFDFQL 347
            .....:|:...|.:....|::.||..|.|..|::   .|..::      .||.||.|
  Fly   297 LVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQLSKQEFEQSLNDFSL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 73/354 (21%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 39/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459488
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.940

Return to query results.
Submit another query.