DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG31974

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:331 Identity:74/331 - (22%)
Similarity:142/331 - (42%) Gaps:52/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TLD-------TKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLVKTTFADRDPAGDVLIHYG 95
            |||       |||    |.||||:|..:..:..: ...|.:....:.|......|      :::.
  Fly    23 TLDSYSTSYLTKP----GDNYGSIMLSVQAKIRS-ADGGIRDLPLIAKLPPLTND------LYWQ 76

  Fly    96 VYTREMD------IYEHILPQL------ADMVRKELKDS-RKLFAATMNVDR-----ERDSIIF- 141
            ::..|..      :|:::.|:|      :.::..::.|. .:.:.:.:::|.     :||:::. 
  Fly    77 IFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQ 141

  Fly   142 EDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKH------ 200
            |:::...|:...|.:..:|..|.|:|..||.:||....|..::|.:::: |.|.:|.|.      
  Fly   142 ENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEE-YVRPYFKKFDMNSNI 205

  Fly   201 TRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERSTTSSPGDFLTLAHGDLWT 265
            .:|...||...:....:.:.|||....|.|..:|     :....:.|.....|.|.||.|||||.
  Fly   206 DQAETEIMNKEILKDIKLVTSDERDVNRVKELLD-----IFQAFQASNDVDDGPFTTLVHGDLWI 265

  Fly   266 TNFMFQYDAKEH---PTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRLT 327
            .|.|.:|..:..   |.....:|||.:.:.|...|:.:...:|:..|:..::....:..||....
  Fly   266 NNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFI 330

  Fly   328 EALRKL 333
            :.||.:
  Fly   331 QTLRSV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 68/315 (22%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 69/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.