DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11878 and CG31436

DIOPT Version :9

Sequence 1:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:414 Identity:110/414 - (26%)
Similarity:184/414 - (44%) Gaps:22/414 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV 77
            |.||.||::...|.....::::|:..|...||.|.|.:|.|:|.|..|:||.:  ||:...:.::
  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNR--KGEFQKSLII 80

  Fly    78 KTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRE-RDSIIF 141
            ||.........|:|....::..||.:|..:||:. :.:.:::.|..:|:...:....| ...:||
  Fly    81 KTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEF-ERILRQVGDDTQLYVNCIYHSLEPHQVLIF 144

  Fly   142 EDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKHTRAYAP 206
            ||::...| :..|.:...|:....:..|||.:||.|..:...||. |.::|..|.|........|
  Fly   145 EDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPE-FLESYTHGLFEMPHVLNDP 207

  Fly   207 IMTNLLEALSRSLASDEELGQRYKAK--------IDRLVERLMDYGERSTTSSPGDFLTLAHGDL 263
            .|...:|.....|..:.|| .:||..        ::||||...|..:   :....::..|.||||
  Fly   208 FMRTGMEFFVELLGKEPEL-NKYKPYFESIKDDFLERLVEEWKDIRK---SQKKDEYWVLCHGDL 268

  Fly   264 WTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRLTE 328
            ...|.||::.......:.:.:|||.|.......||.|.....|:...|..:..:|:.:|...|.:
  Fly   269 HLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQD 333

  Fly   329 ALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSESGMRFKNS 393
            .|:|:.|.|.:||......:.....:|..|....|.|:|.....:......:|.:.|.  |.|.|
  Fly   334 VLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRDKSVDFGDLLQNEEK--RRKCS 396

  Fly   394 VYESENIKKKLSVTLPFLDQFGLL 417
            .  |:...|::::.|..|||.|||
  Fly   397 F--SKGYIKEVTILLARLDQLGLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 76/296 (26%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 76/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.