powered by:
Protein Alignment CG11878 and E02C12.8
DIOPT Version :9
Sequence 1: | NP_651369.1 |
Gene: | CG11878 / 43050 |
FlyBaseID: | FBgn0039310 |
Length: | 420 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379850.1 |
Gene: | E02C12.8 / 179320 |
WormBaseID: | WBGene00017093 |
Length: | 141 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 27/66 - (40%) |
Gaps: | 12/66 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 RGFYAVFCSLIFEPVMQ--YEGKE-------DASIEQVLSSSESGMRFKNSV-YESENIKKKLSV 406
:||.:....| ||..| .|||| ..|.:..|.:....|.|:... :..|.:||..|:
Worm 47 KGFMSRIACL--EPDWQNIEEGKELPSKFALKISSQLALVALSKIMNFEEGAGFSEEKLKKFSSL 109
Fly 407 T 407
|
Worm 110 T 110
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11878 | NP_651369.1 |
EcKinase |
47..335 |
CDD:281023 |
|
E02C12.8 | NP_001379850.1 |
PKc_like |
3..>141 |
CDD:419665 |
19/66 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.