DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10425 and TSC10A

DIOPT Version :9

Sequence 1:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001325788.1 Gene:TSC10A / 819779 AraportID:AT3G06060 Length:343 Species:Arabidopsis thaliana


Alignment Length:306 Identity:104/306 - (33%)
Similarity:157/306 - (51%) Gaps:13/306 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVFCVGIAVLVHVLVYVFVMAKKPRS--IVGRHVVVTGGSKGIGLCLAVECAMKGANVTVIARDE 69
            ::|.:.|..|..:.:...::..:|..  |..||..:||||.||||.||...|.:||.|:::||..
plant    26 LLFLIPIIPLSLLAILALIVRPRPIKIPIKSRHAFITGGSSGIGLALAHRAASEGARVSILARSG 90

  Fly    70 KMLSGAVALMEVIRQRPDQKFQYRSLDISGDYDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFE 134
            ..|..|...:::........|   |.|:. |||.|:|.:    |..|||..||...|:.......
plant    91 SKLEEAKKSIQLATGVEVATF---SADVR-DYDAVSKAI----DESGPIDVLIVNQGVFTAKELV 147

  Fly   135 EVSVQDVHKLMNVNFFGTYNCTRYVLPKM---KKAGDGIIVITASQAAMFGIYGYGPYSATKYAL 196
            :.|.:||...::||..|::|..:..||.|   |..|...|.:.:|||...|:|||..|||:|:.|
plant   148 KHSPEDVKFTIDVNLVGSFNVIKAALPAMKARKDRGPASISLVSSQAGQVGVYGYAAYSASKFGL 212

  Fly   197 RAMAETIAMESREHGVSVTLAMPCDTNTPGFEEEEKSKPRETKIISGGGGLIEPEVMAKAILKDA 261
            :.:|:.:..|.....:.|||..|.||||||||||:||:|..|.||:...|.:|.|.:||..:...
plant   213 QGLAQALQQEVISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAIIAASSGSMETEEVAKKAMDGI 277

  Fly   262 LKGKFTSTVGAESWLITTLGGALLPWDGFFTNLLHAIVLGPLRIVS 307
            ..|.||.:...|.:|::.....:.|...|:...|..|..||:|:::
plant   278 KAGNFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 90/238 (38%)
adh_short 36..229 CDD:278532 73/195 (37%)
TSC10ANP_001325788.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1863
eggNOG 1 0.900 - - E1_KOG1210
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1539
Inparanoid 1 1.050 165 1.000 Inparanoid score I1587
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1210617at2759
OrthoFinder 1 1.000 - - FOG0004308
OrthoInspector 1 1.000 - - otm3249
orthoMCL 1 0.900 - - OOG6_102003
Panther 1 1.100 - - O PTHR43550
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1429
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.