DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10425 and kdsr

DIOPT Version :9

Sequence 1:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001072722.1 Gene:kdsr / 780179 XenbaseID:XB-GENE-985089 Length:332 Species:Xenopus tropicalis


Alignment Length:332 Identity:129/332 - (38%)
Similarity:198/332 - (59%) Gaps:5/332 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVFCVGIAVLVHVLVYVF--VMAKKPRSIVGRHVVVTGGSKGIGLCLAVECAMKGANVTVIARDE 69
            ::......|...:|:|:.  :::.||..:.|.||||||||.|||.|:||||..:||.:|::||||
 Frog     2 LLLAAAFLVAFVLLLYMVSPLISPKPLKLAGAHVVVTGGSSGIGKCVAVECFKQGAFITLVARDE 66

  Fly    70 KMLSGAVALMEVIRQRPDQKFQYRSLDISGDYDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFE 134
            ..|..|...:|.......|.....|:|||.||.||..|:.:.::..||:..|:|||||||.|.||
 Frog    67 GKLVQAKKEIEKYSINDKQVVLCISVDISKDYRQVENVIKQAQEKLGPVDMLVNCAGMAIAGNFE 131

  Fly   135 EVSVQDVHKLMNVNFFGTYNCTRYVLPKMKKAGDGIIVITASQAAMFGIYGYGPYSATKYALRAM 199
            |:.:....:||.:|:.|:...:|.|:..||:...|.||..:|||...|::||..||.||:|||.:
 Frog   132 EIEIDKFARLMEINYLGSVYPSRAVISTMKERRMGRIVFVSSQAGQLGLFGYTAYSPTKFALRGL 196

  Fly   200 AETIAMESREHGVSVTLAMPCDTNTPGFEEEEKSKPRETKIISGGGGLIEPEVMAKAILKDALKG 264
            ||.:.||.:.:.:.||:|.|.||:||||.||.|:||.|||:||....|.:.:.:|:.|:|||::|
 Frog   197 AEALQMEVKPYNIYVTVAYPPDTDTPGFAEENKTKPLETKLISESSSLCQADQVARVIVKDAIQG 261

  Fly   265 KFTSTVGAESWLITTLGGALLPWDGFFTNLLHAIVLGPLRIVSYALHKYFNSVIRKCAREDKAKA 329
            .|.|:||::.:::::|...:.|.......|...:.:|..||::......|:|::|:|..:   |.
 Frog   262 NFNSSVGSDGYMLSSLTCGMSPVTTITEGLQQVVTMGLFRIIALFYLGSFDSIVRRCMIQ---KH 323

  Fly   330 TSQVESK 336
            .||...|
 Frog   324 NSQKSCK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 108/235 (46%)
adh_short 36..229 CDD:278532 88/192 (46%)
kdsrNP_001072722.1 KDSR-like_SDR_c 32..268 CDD:187643 108/235 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3569
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1539
Inparanoid 1 1.050 240 1.000 Inparanoid score I3263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210617at2759
OrthoFinder 1 1.000 - - FOG0004308
OrthoInspector 1 1.000 - - oto104570
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1429
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.