DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10425 and pigf

DIOPT Version :9

Sequence 1:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001016071.1 Gene:pigf / 548825 XenbaseID:XB-GENE-949575 Length:219 Species:Xenopus tropicalis


Alignment Length:57 Identity:16/57 - (28%)
Similarity:27/57 - (47%) Gaps:10/57 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 IISGGGGLIEPEVMAKAILKDALKGKFTST-----VGA--ESWL-ITTLGGALLPWD 288
            |:..|..|:|.  :|:..|...|...||::     :|.  .:|: :.:..|||..||
 Frog    98 IVLYGAPLVES--VAETFLFAVLLSSFTTSRCLCLLGPNFSAWVRVFSKDGALSVWD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 9/35 (26%)
adh_short 36..229 CDD:278532
pigfNP_001016071.1 PIG-F 21..204 CDD:369042 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1750
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.