powered by:
Protein Alignment CG10425 and pigf
DIOPT Version :9
Sequence 1: | NP_651363.1 |
Gene: | CG10425 / 43043 |
FlyBaseID: | FBgn0039304 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016071.1 |
Gene: | pigf / 548825 |
XenbaseID: | XB-GENE-949575 |
Length: | 219 |
Species: | Xenopus tropicalis |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 27/57 - (47%) |
Gaps: | 10/57 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 IISGGGGLIEPEVMAKAILKDALKGKFTST-----VGA--ESWL-ITTLGGALLPWD 288
|:..|..|:|. :|:..|...|...||:: :|. .:|: :.:..|||..||
Frog 98 IVLYGAPLVES--VAETFLFAVLLSSFTTSRCLCLLGPNFSAWVRVFSKDGALSVWD 152
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1750 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.