DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10425 and CG2065

DIOPT Version :9

Sequence 1:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:109/277 - (39%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRHVVVTGGSKGIGLCLAVECAMKGANVTVIARD----EKMLSGAVALMEVIRQRPDQKFQYRSL 95
            |:..:|||.:.|||....:|.|.:|..|.:..||    ||      |..::||:..:|....|.|
  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEK------ARQDIIRETNNQNIFSREL 72

  Fly    96 DISGDYDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFEEVSVQDVHKL-MNVNFFGTYNCTRYV 159
            |:| ..:.:.|.....:.....::.|||.||:..|   .....:|..:: :.||..|.:..|..:
  Fly    73 DLS-SLESIRKFAAGFKKEQDKLHVLINNAGVMHC---PRTLTKDGFEMQLGVNHMGHFLLTHLL 133

  Fly   160 LPKMKKAGDGIIVITASQAAMFGI-----------YG-YGPYSATKYALRAMAETIAMESREHGV 212
            |..:||.....||..:|.....|.           |. .|.||.:|.|.......:|  .|..|.
  Fly   134 LDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELA--KRLEGT 196

  Fly   213 SVTLAMPCDTNT--PGFEEEEKSKPRETKIISGGGGLIEPEVMAKAILKDALKGKF-TSTVGAES 274
            .||      ||:  ||..:.|.|  |..|.:.        ...|:.:||..|...| |...||::
  Fly   197 GVT------TNSLHPGAVDTELS--RNWKFLK--------HPFAQLLLKPLLWVLFKTPRNGAQT 245

  Fly   275 WLITTLGGALLPWDGFF 291
            .|...|..||....|.:
  Fly   246 TLYAALDPALKDVSGLY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 67/255 (26%)
adh_short 36..229 CDD:278532 56/211 (27%)
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 74/277 (27%)
NADB_Rossmann 14..288 CDD:304358 74/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.