DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11857 and ATRER1A

DIOPT Version :9

Sequence 1:NP_001303417.1 Gene:CG11857 / 43042 FlyBaseID:FBgn0039303 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001329643.1 Gene:ATRER1A / 830077 AraportID:AT4G39220 Length:191 Species:Arabidopsis thaliana


Alignment Length:184 Identity:92/184 - (50%)
Similarity:123/184 - (66%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DSSAAGGGGVKKFFQRLS----QTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWYIVCY 65
            |.|....|.|....|:.:    :.||..||::|||...||:....:.|::.||::..||:||:.|
plant     2 DESGGDSGSVATPVQQRAHEAWRIYQHYLDKTTPHANYRWIGTLVVALIYCLRVYYIQGFYIIAY 66

  Fly    66 ALGIYHLNLFIAFLTPKIDPEFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVAKSTL 130
            .||||.|||.|.||:|.:|||....|     :||:||||.::||:||||||||||||.|:.|:..
plant    67 GLGIYLLNLLIGFLSPLVDPEAGGVS-----DGPSLPTRGSDEFKPFIRRLPEFKFWYSMTKAFC 126

  Fly   131 IGLICTFFDFFNVPVFWPILVMYFITLFCITMKRQIKHMIKYKYLPFTRNKPRY 184
            |..:.|||..|:||||||||:.|:|.||.:||:|||.|||||||:||:..|.:|
plant   127 IAFLMTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFSFGKQKY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11857NP_001303417.1 Rer1 17..185 CDD:281266 88/172 (51%)
ATRER1ANP_001329643.1 Rer1 17..181 CDD:397380 87/169 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 190 1.000 Domainoid score I945
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5468
Inparanoid 1 1.050 191 1.000 Inparanoid score I1374
OMA 1 1.010 - - QHG54010
OrthoDB 1 1.010 - - D1458086at2759
OrthoFinder 1 1.000 - - FOG0003808
OrthoInspector 1 1.000 - - otm2622
orthoMCL 1 0.900 - - OOG6_101272
Panther 1 1.100 - - O PTHR10743
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2191
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.