DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11857 and rer1

DIOPT Version :9

Sequence 1:NP_001303417.1 Gene:CG11857 / 43042 FlyBaseID:FBgn0039303 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001011464.1 Gene:rer1 / 496955 XenbaseID:XB-GENE-954178 Length:198 Species:Xenopus tropicalis


Alignment Length:184 Identity:117/184 - (63%)
Similarity:140/184 - (76%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKKFFQRLSQTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWYIVCYALGIYHLNLFIAF 78
            |.:||.||.|.|||.||:|||.|.:|||....|..::::|::|.||||||.||||||||||||||
 Frog    18 VFRFFSRLGQIYQSFLDKSTPFTAIRWVMTLGLSFIYMIRVYILQGWYIVTYALGIYHLNLFIAF 82

  Fly    79 LTPKIDPEFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVAKSTLIGLICTFFDFFNV 143
            |:||:||..    .:|.||||:|||:.|||||||||||||||||.|..|..::.::|||||.|||
 Frog    83 LSPKVDPSL----MEDSDEGPSLPTKQNEEFRPFIRRLPEFKFWHSATKGIVVAMVCTFFDAFNV 143

  Fly   144 PVFWPILVMYFITLFCITMKRQIKHMIKYKYLPFTRNKPRYQRVNDLAGSGPGS 197
            ||||||||||||.||||||||||||||||:|:|||..|.:|:...:.....|.|
 Frog   144 PVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRKYKGKEEPTSGKPFS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11857NP_001303417.1 Rer1 17..185 CDD:281266 113/167 (68%)
rer1NP_001011464.1 Rer1 20..185 CDD:367416 113/168 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 248 1.000 Domainoid score I2090
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5468
Inparanoid 1 1.050 253 1.000 Inparanoid score I3124
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458086at2759
OrthoFinder 1 1.000 - - FOG0003808
OrthoInspector 1 1.000 - - oto105206
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1080
SonicParanoid 1 1.000 - - X2191
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.