DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11857 and rer1

DIOPT Version :9

Sequence 1:NP_001303417.1 Gene:CG11857 / 43042 FlyBaseID:FBgn0039303 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_956969.1 Gene:rer1 / 393648 ZFINID:ZDB-GENE-040426-1494 Length:196 Species:Danio rerio


Alignment Length:193 Identity:121/193 - (62%)
Similarity:140/193 - (72%) Gaps:9/193 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MNEDSSAAGG-----GGVKKFFQRLSQTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWY 61
            |.|..||...     ..:..||:||.|.|||.||:|||.:.:||.....|..::::|::|.||||
Zfish     1 MPEGDSAGESIHGKPSAIGNFFKRLGQIYQSWLDKSTPFSAVRWASTLILTAIYMIRVYILQGWY 65

  Fly    62 IVCYALGIYHLNLFIAFLTPKIDPEFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVA 126
            ||.|||||||||||||||:||:||..    .||.||||.|||:.|||||||||||||||||.|..
Zfish    66 IVTYALGIYHLNLFIAFLSPKVDPSL----LDDPDEGPALPTKQNEEFRPFIRRLPEFKFWHSAT 126

  Fly   127 KSTLIGLICTFFDFFNVPVFWPILVMYFITLFCITMKRQIKHMIKYKYLPFTRNKPRYQRVND 189
            |..:|.:||||||.|||||||||||||||.||||||||||||||||:|||||..|..|:..:|
Zfish   127 KGIVIAMICTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYLPFTHGKRTYRGKDD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11857NP_001303417.1 Rer1 17..185 CDD:281266 115/167 (69%)
rer1NP_956969.1 Rer1 21..184 CDD:281266 115/166 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579861
Domainoid 1 1.000 245 1.000 Domainoid score I2135
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5468
Inparanoid 1 1.050 249 1.000 Inparanoid score I3225
OMA 1 1.010 - - QHG54010
OrthoDB 1 1.010 - - D1458086at2759
OrthoFinder 1 1.000 - - FOG0003808
OrthoInspector 1 1.000 - - oto41223
orthoMCL 1 0.900 - - OOG6_101272
Panther 1 1.100 - - LDO PTHR10743
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1080
SonicParanoid 1 1.000 - - X2191
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.