DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11857 and Rer1

DIOPT Version :9

Sequence 1:NP_001303417.1 Gene:CG11857 / 43042 FlyBaseID:FBgn0039303 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001034101.1 Gene:Rer1 / 298675 RGDID:1306324 Length:196 Species:Rattus norvegicus


Alignment Length:177 Identity:115/177 - (64%)
Similarity:140/177 - (79%) Gaps:4/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKKFFQRLSQTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWYIVCYALGIYHLNLFIAF 78
            |.:||.||.|.|||.||:|||:|.:|||....|..::::|:::.||||||.||||||||||||||
  Rat    18 VYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAF 82

  Fly    79 LTPKIDPEFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVAKSTLIGLICTFFDFFNV 143
            |:||:||..    .:|.|:||:|||:.|||||||||||||||||.:..|..|:.:|||||:.|||
  Rat    83 LSPKVDPSL----MEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFEAFNV 143

  Fly   144 PVFWPILVMYFITLFCITMKRQIKHMIKYKYLPFTRNKPRYQRVNDL 190
            ||||||||||||.||||||||||||||||:|:|||..|.||:...|:
  Rat   144 PVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYKGKEDV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11857NP_001303417.1 Rer1 17..185 CDD:281266 112/167 (67%)
Rer1NP_001034101.1 Rer1 20..185 CDD:397380 112/168 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340041
Domainoid 1 1.000 247 1.000 Domainoid score I2102
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5468
Inparanoid 1 1.050 251 1.000 Inparanoid score I3137
OMA 1 1.010 - - QHG54010
OrthoDB 1 1.010 - - D1458086at2759
OrthoFinder 1 1.000 - - FOG0003808
OrthoInspector 1 1.000 - - oto98518
orthoMCL 1 0.900 - - OOG6_101272
Panther 1 1.100 - - LDO PTHR10743
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2191
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.