DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11857 and rer1

DIOPT Version :9

Sequence 1:NP_001303417.1 Gene:CG11857 / 43042 FlyBaseID:FBgn0039303 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_594831.1 Gene:rer1 / 2541774 PomBaseID:SPAC22E12.05c Length:184 Species:Schizosaccharomyces pombe


Alignment Length:170 Identity:88/170 - (51%)
Similarity:118/170 - (69%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKFFQRLSQTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWYIVCYALGIYHLNLFIAFL 79
            |.|..||   |:..:||:.|:|..||:....|:.||.:||.:.:|||||||.|.||.||||:|||
pombe    15 KNFAVRL---YRHWVDRTIPYTTYRWLTVSGLIALFFIRILLVRGWYIVCYTLAIYLLNLFLAFL 76

  Fly    80 TPKIDPEFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVAKSTLIGLICTFFDFFNVP 144
            |||.||..:...:|:|.|...|||..::|||||||||||||||.|..::||..|:.:||..|:||
pombe    77 TPKFDPSVEQAMKDEEIEEGVLPTSKDDEFRPFIRRLPEFKFWYSSMRATLFALVASFFRIFDVP 141

  Fly   145 VFWPILVMYFITLFCITMKRQIKHMIKYKYLPFTRNKPRY 184
            |||||||:|::.|.....:|||:||:||:|:||...|.::
pombe   142 VFWPILVVYYLVLSFFCFRRQIQHMLKYRYVPFDIGKKKF 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11857NP_001303417.1 Rer1 17..185 CDD:281266 87/168 (52%)
rer1NP_594831.1 RER1 1..184 CDD:227574 88/170 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 187 1.000 Domainoid score I754
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5468
Inparanoid 1 1.050 188 1.000 Inparanoid score I1062
OMA 1 1.010 - - QHG54010
OrthoFinder 1 1.000 - - FOG0003808
OrthoInspector 1 1.000 - - oto101987
orthoMCL 1 0.900 - - OOG6_101272
Panther 1 1.100 - - LDO PTHR10743
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1080
SonicParanoid 1 1.000 - - X2191
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.